SCOPe 2.04: Domain d3nq6b_: 3nq6 B:

Lineage for d3nq6b_ (3nq6 B:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families)

5. Family c.1.2.3: Decarboxylase [51375] (4 proteins)

6. Protein automated matches [190130] (11 species)
   not a true protein

7. Species Methanothermobacter thermautotrophicus [TaxId:145262] [189782] (26 PDB entries)

8. Domain d3nq6b_: 3nq6 B: [182469]
   automated match to d1dv7a_
   complexed with gol, up6; mutant

Details for d3nq6b_

PDB Entry: 3nq6, 1.49 Å

PDB Description: Crystal structure of the mutant P180A of orotidine 5'-monophosphate decarboxylase from Methanobacterium thermoautotrophicum complexed with inhibitor 6-azaUMP

PDB Compounds: (B:) orotidine 5'-phosphate decarboxylase

SCOPe Domain Sequences for d3nq6b_:

Sequence; same for both SEQRES and ATOM records:

>d3nq6b_ c.1.2.3 (B:) automated matches {Methanothermobacter thermautotrophicus [TaxId: 145262]}
mdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfgcrii
adfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevflltemsh
pgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflisagvgaqggd
pgetlrfadaiivgrsiyladnpaaaaagiiesikdll

Timeline for d3nq6b_:

• d3nq6b_ first appeared in SCOPe 2.01
  
• d3nq6b_ appears in SCOPe 2.03
  
• d3nq6b_ appears in SCOPe 2.05
  
• d3nq6b_ appears in the current release, SCOPe 2.08