Lineage for d3nq3a_ (3nq3 A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1324198Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 1324199Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 1324200Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
    barrel, closed; n=8, S=12, meander
  6. 1324223Protein beta-Lactoglobulin [50827] (3 species)
  7. 1324224Species Cow (Bos taurus) [TaxId:9913] [50828] (39 PDB entries)
    Uniprot P02754
  8. 1324234Domain d3nq3a_: 3nq3 A: [182467]
    automated match to d1bsqa_
    complexed with cl, dka, gol

Details for d3nq3a_

PDB Entry: 3nq3 (more details), 1.9 Å

PDB Description: Bovine beta-lactoglobulin complex with capric acid
PDB Compounds: (A:) beta-lactoglobulin

SCOPe Domain Sequences for d3nq3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nq3a_ b.60.1.1 (A:) beta-Lactoglobulin {Cow (Bos taurus) [TaxId: 9913]}
livtqtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegdleillqk
wengecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslacq
clvrtpevddealekfdkalkalpmhirlsfnptqleeqchi

SCOPe Domain Coordinates for d3nq3a_:

Click to download the PDB-style file with coordinates for d3nq3a_.
(The format of our PDB-style files is described here.)

Timeline for d3nq3a_: