Class b: All beta proteins [48724] (174 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins) |
Protein Matriptase MTSP1 [69284] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [69285] (16 PDB entries) |
Domain d3npsa_: 3nps A: [182466] Other proteins in same PDB: d3npsc1, d3npsc2 automated match to d1eawa_ complexed with cl, edo, na |
PDB Entry: 3nps (more details), 1.5 Å
SCOPe Domain Sequences for d3npsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3npsa_ b.47.1.2 (A:) Matriptase MTSP1 {Human (Homo sapiens) [TaxId: 9606]} vvggtdadegewpwqvslhalgqghicgaslispnwlvsaahcyiddrgfrysdptqwta flglhdqsqrsapgvqerrlkriishpffndftfdydiallelekpaeyssmvrpislpd ashvfpagkaiwvtgwghtqyggtgalilqkgeirvinqttcenllpqqitprmmcvgfl sggvdscqgdsggplssveadgrifqagvvswgdgcaqrnkpgvytrlplfrdwikentg v
Timeline for d3npsa_: