Lineage for d3nplb_ (3npl B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2004933Family a.104.1.1: Cytochrome P450 [48265] (23 protein domains)
  6. 2005023Protein Cytochrome P450 bm-3 [48268] (1 species)
  7. 2005024Species Bacillus megaterium [TaxId:1404] [48269] (76 PDB entries)
    Uniprot P14779
  8. 2005133Domain d3nplb_: 3npl B: [182464]
    automated match to d1jpza_
    complexed with hem, ru8, so4; mutant

Details for d3nplb_

PDB Entry: 3npl (more details), 2.4 Å

PDB Description: Structure of Ru(bpy)2(A-Phen)(K97C) P450 BM3 heme domain, a ruthenium modified P450 BM3 mutant
PDB Compounds: (B:) Bifunctional P-450/NADPH-P450 reductase

SCOPe Domain Sequences for d3nplb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nplb_ a.104.1.1 (B:) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]}
mpqpktfgelknlpllntdkpvqalmkiadelgeifkfeapgrvtrylssqrlikeaade
srfdknlsqalkfvrdfagdglftswtheknwckahnillpsfsqqamkgyhammvdiav
qlvqkwerlnadehievpedmtrltldtiglsgfnyrfnsfyrdqphpfitsmvraldea
mnklqranpddpaydenkrqfqedikvmndlvdkiiadrkasgeqsddllthmlngkdpe
tgeplddeniryqiitfliaghettsgllsfalyflvknphvlqkaaeeaarvlvdpvps
ykqvkqlkyvgmvlnealrlwptapafslyakedtvlggeyplekgdelmvlipqlhrdk
tiwgddveefrperfenpsaipqhafkpfgngqracigqqfalheatlvlgmmlkhfdfe
dhtnyeldiketltlkpegfvvkakskkiplggips

SCOPe Domain Coordinates for d3nplb_:

Click to download the PDB-style file with coordinates for d3nplb_.
(The format of our PDB-style files is described here.)

Timeline for d3nplb_: