| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
| Family a.25.1.1: Ferritin [47241] (10 proteins) |
| Protein automated matches [190041] (34 species) not a true protein |
| Species Horse (Equus caballus) [TaxId:9796] [187199] (6 PDB entries) |
| Domain d3np2x_: 3np2 X: [182454] automated match to d1hrsa_ complexed with cd, edo, pd, pll, so4 |
PDB Entry: 3np2 (more details), 1.86 Å
SCOPe Domain Sequences for d3np2x_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3np2x_ a.25.1.1 (X:) automated matches {Horse (Equus caballus) [TaxId: 9796]}
sqirqnysteveaavnrlvnlylrasytylslgfyfdrddvalcgvahffrelaeekreg
aerllkmqnqrggralfqdlqkpsqdewgttldamkaaivlekslnqalldlhalgsaqa
dphlcdfleshfldeevklikkmgdhltniqrlvgsqaglgeylferltlkh
Timeline for d3np2x_: