Lineage for d3np2x_ (3np2 X:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2312408Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2312409Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2312410Family a.25.1.1: Ferritin [47241] (10 protein domains)
  6. 2313377Protein automated matches [190041] (30 species)
    not a true protein
  7. 2313638Species Horse (Equus caballus) [TaxId:9796] [187199] (6 PDB entries)
  8. 2313644Domain d3np2x_: 3np2 X: [182454]
    automated match to d1hrsa_
    complexed with cd, edo, pd, pll, so4

Details for d3np2x_

PDB Entry: 3np2 (more details), 1.86 Å

PDB Description: Crystal Structure of Pd(allyl)/apo-E45C/C48A-rHLFr
PDB Compounds: (X:) ferritin light chain

SCOPe Domain Sequences for d3np2x_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3np2x_ a.25.1.1 (X:) automated matches {Horse (Equus caballus) [TaxId: 9796]}
sqirqnysteveaavnrlvnlylrasytylslgfyfdrddvalcgvahffrelaeekreg
aerllkmqnqrggralfqdlqkpsqdewgttldamkaaivlekslnqalldlhalgsaqa
dphlcdfleshfldeevklikkmgdhltniqrlvgsqaglgeylferltlkh

SCOPe Domain Coordinates for d3np2x_:

Click to download the PDB-style file with coordinates for d3np2x_.
(The format of our PDB-style files is described here.)

Timeline for d3np2x_: