Lineage for d3nofa_ (3nof A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2880025Species Mycobacterium tuberculosis [TaxId:419947] [189518] (1 PDB entry)
  8. 2880026Domain d3nofa_: 3nof A: [182450]
    automated match to d1nw2a_
    complexed with scn; mutant

Details for d3nofa_

PDB Entry: 3nof (more details), 1.6 Å

PDB Description: Mycobacterium tuberculosis thioredoxin C C40S mutant
PDB Compounds: (A:) Thioredoxin TrxC

SCOPe Domain Sequences for d3nofa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nofa_ c.47.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 419947]}
satikvtdasfatdvlssnkpvlvdfwatwcgpskmvapvleeiateratdltvakldvd
tnpetarnfqvvsiptlilfkdgqpvkrivgakgkaallrelsdvv

SCOPe Domain Coordinates for d3nofa_:

Click to download the PDB-style file with coordinates for d3nofa_.
(The format of our PDB-style files is described here.)

Timeline for d3nofa_: