![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.1: Ubiquitin-like [54236] (11 families) ![]() |
![]() | Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
![]() | Protein automated matches [190118] (16 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [189560] (113 PDB entries) |
![]() | Domain d3nobc1: 3nob C:1-74 [182442] Other proteins in same PDB: d3noba2, d3nobc2, d3nobd2, d3nobe2, d3nobh2 automated match to d1aara_ complexed with so4 |
PDB Entry: 3nob (more details), 2.19 Å
SCOPe Domain Sequences for d3nobc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3nobc1 d.15.1.1 (C:1-74) automated matches {Human (Homo sapiens) [TaxId: 9606]} mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn iqkestlhlvlrlr
Timeline for d3nobc1: