Lineage for d3noab_ (3noa B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2728284Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2728285Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2728286Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2728976Protein Peroxisome proliferator activated receptor gamma, PPAR-gamma [48524] (1 species)
  7. 2728977Species Human (Homo sapiens) [TaxId:9606] [48525] (172 PDB entries)
    Uniprot P37231 232-505
  8. 2728994Domain d3noab_: 3noa B: [182439]
    automated match to d1fm6d_
    complexed with 5bc

Details for d3noab_

PDB Entry: 3noa (more details), 1.98 Å

PDB Description: Crystal structure of human PPAR-gamma ligand binding domain complex with a potency improved agonist
PDB Compounds: (B:) Peroxisome proliferator-activated receptor gamma

SCOPe Domain Sequences for d3noab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3noab_ a.123.1.1 (B:) Peroxisome proliferator activated receptor gamma, PPAR-gamma {Human (Homo sapiens) [TaxId: 9606]}
esadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikfkh
itplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheii
ytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlai
fiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqiv
tehvqllqvikktetdmslhpllqeiykdly

SCOPe Domain Coordinates for d3noab_:

Click to download the PDB-style file with coordinates for d3noab_.
(The format of our PDB-style files is described here.)

Timeline for d3noab_: