Lineage for d3no6d_ (3no6 D:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2015324Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. 2015325Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 2015566Family a.132.1.0: automated matches [191333] (1 protein)
    not a true family
  6. 2015567Protein automated matches [190172] (9 species)
    not a true protein
  7. 2015610Species Staphylococcus epidermidis [TaxId:176280] [189423] (1 PDB entry)
  8. 2015614Domain d3no6d_: 3no6 D: [182437]
    Other proteins in same PDB: d3no6a2
    automated match to d1to9b_
    complexed with act, imd, mpd, mrd, so4

Details for d3no6d_

PDB Entry: 3no6 (more details), 1.65 Å

PDB Description: crystal structure of a putative thiaminase ii (se1693) from staphylococcus epidermidis atcc 12228 at 1.65 a resolution
PDB Compounds: (D:) Transcriptional activator tenA

SCOPe Domain Sequences for d3no6d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3no6d_ a.132.1.0 (D:) automated matches {Staphylococcus epidermidis [TaxId: 176280]}
mtfskelreasrpiiddiyndgfiqdllagklsnqavrqylradasylkeftniyamlip
kmssmedvkflveqiefmlegeveahevladfinepyeeivkekvwppsgdhyikhmyfn
afarenaaftiaamapcpyvyavigkramedpklnkesvtskwfqfystemdelvdvfdq
lmdrltkhcsetekkeikenflqstiherhffnmayinekweyggnn

SCOPe Domain Coordinates for d3no6d_:

Click to download the PDB-style file with coordinates for d3no6d_.
(The format of our PDB-style files is described here.)

Timeline for d3no6d_: