| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.132: Heme oxygenase-like [48612] (1 superfamily) multihelical; bundle |
Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) ![]() duplication: contains two structural repeats of 3-helical motif |
| Family a.132.1.0: automated matches [191333] (1 protein) not a true family |
| Protein automated matches [190172] (9 species) not a true protein |
| Species Staphylococcus epidermidis [TaxId:176280] [189423] (1 PDB entry) |
| Domain d3no6d_: 3no6 D: [182437] Other proteins in same PDB: d3no6a2 automated match to d1to9b_ complexed with act, imd, mpd, mrd, so4 |
PDB Entry: 3no6 (more details), 1.65 Å
SCOPe Domain Sequences for d3no6d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3no6d_ a.132.1.0 (D:) automated matches {Staphylococcus epidermidis [TaxId: 176280]}
mtfskelreasrpiiddiyndgfiqdllagklsnqavrqylradasylkeftniyamlip
kmssmedvkflveqiefmlegeveahevladfinepyeeivkekvwppsgdhyikhmyfn
afarenaaftiaamapcpyvyavigkramedpklnkesvtskwfqfystemdelvdvfdq
lmdrltkhcsetekkeikenflqstiherhffnmayinekweyggnn
Timeline for d3no6d_:
View in 3DDomains from other chains: (mouse over for more information) d3no6a1, d3no6a2, d3no6b_, d3no6c_ |