SCOPe 2.08: Domain d3no6a1: 3no6 A:1-227

Lineage for d3no6a1 (3no6 A:1-227)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
   multihelical; bundle

4. Superfamily a.132.1: Heme oxygenase-like [48613] (5 families)
   duplication: contains two structural repeats of 3-helical motif

5. Family a.132.1.0: automated matches [191333] (1 protein)
   not a true family

6. Protein automated matches [190172] (9 species)
   not a true protein

7. Species Staphylococcus epidermidis [TaxId:176280] [189423] (1 PDB entry)

8. Domain d3no6a1: 3no6 A:1-227 [182434]
   Other proteins in same PDB: d3no6a2
   automated match to d1to9b_
   complexed with act, imd, mpd, mrd, so4

Details for d3no6a1

PDB Entry: 3no6, 1.65 Å

PDB Description: crystal structure of a putative thiaminase ii (se1693) from staphylococcus epidermidis atcc 12228 at 1.65 a resolution

PDB Compounds: (A:) Transcriptional activator tenA

SCOPe Domain Sequences for d3no6a1:

Sequence; same for both SEQRES and ATOM records:

>d3no6a1 a.132.1.0 (A:1-227) automated matches {Staphylococcus epidermidis [TaxId: 176280]}
mtfskelreasrpiiddiyndgfiqdllagklsnqavrqylradasylkeftniyamlip
kmssmedvkflveqiefmlegeveahevladfinepyeeivkekvwppsgdhyikhmyfn
afarenaaftiaamapcpyvyavigkramedpklnkesvtskwfqfystemdelvdvfdq
lmdrltkhcsetekkeikenflqstiherhffnmayinekweyggnn

Timeline for d3no6a1:

• d3no6a1 first appeared in SCOPe 2.01, called d3no6a_
  
• d3no6a1 appears in SCOPe 2.07