![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
![]() | Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) ![]() |
![]() | Family c.66.1.3: Fibrillarin homologue [53342] (1 protein) automatically mapped to Pfam PF01269 |
![]() | Protein Fibrillarin homologue [53343] (4 species) |
![]() | Species Pyrococcus furiosus [TaxId:2261] [224904] (3 PDB entries) |
![]() | Domain d3nmuj_: 3nmu J: [182414] automated match to d1prya_ protein/RNA complex; complexed with sam |
PDB Entry: 3nmu (more details), 2.73 Å
SCOPe Domain Sequences for d3nmuj_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3nmuj_ c.66.1.3 (J:) Fibrillarin homologue {Pyrococcus furiosus [TaxId: 2261]} mvevkkhkfpgvyvvidddgsekiatknlvpgqrvygervikwegeeyriwnphrsklga aivnglknfpikpgksvlylgiasgttashvsdivgwegkiygiefsprvlrelvpivee rrniipilgdatkpeeyralvtkvdvifedvaqptqakilidnakaylkrggygmiavks rsidvtkepeqvfkeverelseyfevierlnlepyekdhalfvvrkp
Timeline for d3nmuj_: