| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.21: HMG-box [47094] (1 superfamily) 3 helices; irregular array |
Superfamily a.21.1: HMG-box [47095] (2 families) ![]() |
| Family a.21.1.1: HMG-box [47096] (10 proteins) |
| Protein automated matches [190434] (3 species) not a true protein |
| Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [189474] (2 PDB entries) |
| Domain d3nm9m_: 3nm9 M: [182394] automated match to d1e7ja_ protein/DNA complex |
PDB Entry: 3nm9 (more details), 2.85 Å
SCOPe Domain Sequences for d3nm9m_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3nm9m_ a.21.1.1 (M:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
sdkpkrplsayalwlnsaresikrenpgikvtevakrggelwramkdkseweakaakakd
dydravkefeang
Timeline for d3nm9m_: