Lineage for d3nm9g_ (3nm9 G:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2697956Fold a.21: HMG-box [47094] (1 superfamily)
    3 helices; irregular array
  4. 2697957Superfamily a.21.1: HMG-box [47095] (2 families) (S)
  5. 2697958Family a.21.1.1: HMG-box [47096] (10 proteins)
  6. 2698017Protein automated matches [190434] (3 species)
    not a true protein
  7. 2698018Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [189474] (2 PDB entries)
  8. 2698021Domain d3nm9g_: 3nm9 G: [182392]
    automated match to d1e7ja_
    protein/DNA complex

Details for d3nm9g_

PDB Entry: 3nm9 (more details), 2.85 Å

PDB Description: hmgd(m13a)-dna complex
PDB Compounds: (G:) high mobility group protein d

SCOPe Domain Sequences for d3nm9g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nm9g_ a.21.1.1 (G:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
sdkpkrplsayalwlnsaresikrenpgikvtevakrggelwramkdkseweakaakakd
dydravkefeang

SCOPe Domain Coordinates for d3nm9g_:

Click to download the PDB-style file with coordinates for d3nm9g_.
(The format of our PDB-style files is described here.)

Timeline for d3nm9g_: