SCOPe 2.01: Domain d3nm9d_: 3nm9 D:

Lineage for d3nm9d_ (3nm9 D:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.21: HMG-box [47094] (1 superfamily)
   3 helices; irregular array

4. Superfamily a.21.1: HMG-box [47095] (2 families)

5. Family a.21.1.1: HMG-box [47096] (10 proteins)

6. Protein automated matches [190434] (3 species)
   not a true protein

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [189474] (1 PDB entry)

8. Domain d3nm9d_: 3nm9 D: [182391]
   automated match to d1e7ja_
   protein/DNA complex

Details for d3nm9d_

PDB Entry: 3nm9, 2.85 Å

PDB Description: hmgd(m13a)-dna complex

PDB Compounds: (D:) high mobility group protein d

SCOPe Domain Sequences for d3nm9d_:

Sequence; same for both SEQRES and ATOM records:

>d3nm9d_ a.21.1.1 (D:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
sdkpkrplsayalwlnsaresikrenpgikvtevakrggelwramkdkseweakaakakd
dydravkefeang

Timeline for d3nm9d_:

• d3nm9d_ is new in SCOPe 2.01-stable
  
• d3nm9d_ appears in SCOPe 2.02
  
• d3nm9d_ appears in the current release, SCOPe 2.08