Lineage for d3nm5a_ (3nm5 A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 996821Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 996837Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 997471Family c.56.2.0: automated matches [191488] (1 protein)
    not a true family
  6. 997472Protein automated matches [190781] (6 species)
    not a true protein
  7. 997518Species Helicobacter pylori [TaxId:85963] [189517] (3 PDB entries)
  8. 997522Domain d3nm5a_: 3nm5 A: [182387]
    automated match to d1jysa_
    complexed with fmc

Details for d3nm5a_

PDB Entry: 3nm5 (more details), 1.8 Å

PDB Description: Helicobacter pylori MTAN complexed with Formycin A
PDB Compounds: (A:) MTA/SAH nucleosidase

SCOPe Domain Sequences for d3nm5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nm5a_ c.56.2.0 (A:) automated matches {Helicobacter pylori [TaxId: 85963]}
qkigilgamreeitpilelfgvdfeeiplggnvfhkgvyhnkeiivayskigkvhstltt
tsmilafgvqkvlfsgvagslvkdlkindllvatqlvqhdvdlsafdhplgfipesaifi
etsgslnalakkianeqhialkegviasgdqfvhskerkeflvsefkasavemegasvaf
vcqkfgvpccvlrsisdnadekagmsfdefleksahtsakflksmvdel

SCOPe Domain Coordinates for d3nm5a_:

Click to download the PDB-style file with coordinates for d3nm5a_.
(The format of our PDB-style files is described here.)

Timeline for d3nm5a_: