Class a: All alpha proteins [46456] (286 folds) |
Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.7: 14-3-3 protein [48445] (1 family) automatically mapped to Pfam PF00244 |
Family a.118.7.1: 14-3-3 protein [48446] (5 proteins) |
Protein zeta isoform [48449] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [48451] (7 PDB entries) |
Domain d3nkxa_: 3nkx A: [182351] automated match to d1qjba_ complexed with ppi |
PDB Entry: 3nkx (more details), 2.4 Å
SCOPe Domain Sequences for d3nkxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3nkxa_ a.118.7.1 (A:) zeta isoform {Human (Homo sapiens) [TaxId: 9606]} dknelvqkaklaeqaeryddmaacmksvteqgaelsneernllsvayknvvgarrsswrv vssieqktegaekkqqmareyrekietelrdicndvlsllekflipnasqaeskvfylkm kgdyyrylaevaagddkkgivdqsqqayqeafeiskkemqpthpirlglalnfsvfyyei lnspekacslaktafdeaiaeldtlseesykdstlimqllrdnltlwts
Timeline for d3nkxa_: