Lineage for d3nkwa_ (3nkw A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1039177Fold d.118: N-acetylmuramoyl-L-alanine amidase-like [55845] (1 superfamily)
    contains mixed beta-sheet
  4. 1039178Superfamily d.118.1: N-acetylmuramoyl-L-alanine amidase-like [55846] (2 families) (S)
  5. 1039179Family d.118.1.1: N-acetylmuramoyl-L-alanine amidase-like [55847] (11 proteins)
    Family 2 zinc amidase;
  6. 1039240Protein automated matches [190549] (3 species)
    not a true protein
  7. 1039241Species Camel (Camelus dromedarius) [TaxId:9838] [188016] (15 PDB entries)
  8. 1039270Domain d3nkwa_: 3nkw A: [182347]
    automated match to d1ycka1
    complexed with nag, tla

Details for d3nkwa_

PDB Entry: 3nkw (more details), 2.6 Å

PDB Description: crystal structure of the complex of peptidoglycan recognition protein (pgrp-s) with n-acetyl glucosamine(nag) at 2.6 a resolution
PDB Compounds: (A:) Peptidoglycan recognition protein 1

SCOPe Domain Sequences for d3nkwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nkwa_ d.118.1.1 (A:) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]}
edppacgsivprrewralasecrerltrpvryvvvshtagshcdtpascaqqaqnvqsyh
vrnlgwcdvgynfligedglvyegrgwnikgahagptwnpisigisfmgnymnrvpppra
lraaqnllacgvalgalrsnyevkghrdvqptlspgdrlyeiiqtwshyra

SCOPe Domain Coordinates for d3nkwa_:

Click to download the PDB-style file with coordinates for d3nkwa_.
(The format of our PDB-style files is described here.)

Timeline for d3nkwa_: