Lineage for d3nkja_ (3nkj A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2697673Fold a.14: VHP, Villin headpiece domain [47049] (1 superfamily)
    3 short helices; irregular array
  4. 2697674Superfamily a.14.1: VHP, Villin headpiece domain [47050] (2 families) (S)
  5. 2697675Family a.14.1.1: VHP, Villin headpiece domain [47051] (5 proteins)
  6. 2697685Protein Villin [47052] (2 species)
  7. 2697686Species Chicken (Gallus gallus) [TaxId:9031] [47053] (13 PDB entries)
  8. 2697692Domain d3nkja_: 3nkj A: [182343]
    automated match to d1qqva_

Details for d3nkja_

PDB Entry: 3nkj (more details), 1.6 Å

PDB Description: Crystal Structure of HP67 L61G
PDB Compounds: (A:) Villin-1

SCOPe Domain Sequences for d3nkja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nkja_ a.14.1.1 (A:) Villin {Chicken (Gallus gallus) [TaxId: 9031]}
letfpldvlvntaaedlprgvdpsrkenhlsdedfkavfgmtrsafangplwkqqnlkke
kglf

SCOPe Domain Coordinates for d3nkja_:

Click to download the PDB-style file with coordinates for d3nkja_.
(The format of our PDB-style files is described here.)

Timeline for d3nkja_: