Lineage for d3nk8a_ (3nk8 A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2387558Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2387559Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2387819Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2388843Protein Trypsin(ogen) [50515] (9 species)
  7. 2388861Species Cow (Bos taurus) [TaxId:9913] [50516] (442 PDB entries)
    Uniprot P00760
  8. 2388904Domain d3nk8a_: 3nk8 A: [182339]
    automated match to d1aq7a_
    complexed with ca, dms, jkz

Details for d3nk8a_

PDB Entry: 3nk8 (more details), 1.15 Å

PDB Description: trypsin in complex with fluorine-containing fragment
PDB Compounds: (A:) cationic trypsin

SCOPe Domain Sequences for d3nk8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nk8a_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

SCOPe Domain Coordinates for d3nk8a_:

Click to download the PDB-style file with coordinates for d3nk8a_.
(The format of our PDB-style files is described here.)

Timeline for d3nk8a_: