Lineage for d3niza1 (3niz A:19-311)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2218047Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2218048Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2218179Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2220941Protein automated matches [190091] (17 species)
    not a true protein
  7. 2221032Species Cryptosporidium parvum [TaxId:353152] [188006] (2 PDB entries)
  8. 2221033Domain d3niza1: 3niz A:19-311 [182332]
    Other proteins in same PDB: d3niza2
    automated match to d1ob3a_
    complexed with adp, mg

Details for d3niza1

PDB Entry: 3niz (more details), 2.4 Å

PDB Description: cryptosporidium parvum cyclin-dependent kinase cgd5_2510 with adp bound.
PDB Compounds: (A:) Rhodanese family protein

SCOPe Domain Sequences for d3niza1:

Sequence, based on SEQRES records: (download)

>d3niza1 d.144.1.7 (A:19-311) automated matches {Cryptosporidium parvum [TaxId: 353152]}
lmekyqklekvgegtygvvykakdsqgrivalkrirldaedegipstaireisllkelhh
pnivslidvihsercltlvfefmekdlkkvldenktglqdsqikiylyqllrgvahchqh
rilhrdlkpqnllinsdgalkladfglarafgipvrsythevvtlwyrapdvlmgskkys
tsvdiwsigcifaemitgkplfpgvtdddqlpkifsilgtpnprewpqvqelplwkqrtf
qvfekkpwssiipgfcqegidllsnmlcfdpnkrisardamnhpyfkdldpqi

Sequence, based on observed residues (ATOM records): (download)

>d3niza1 d.144.1.7 (A:19-311) automated matches {Cryptosporidium parvum [TaxId: 353152]}
lmekyqklekvgegtygvvykakdsqgrivalkrirgipstaireisllkelhhpnivsl
idvihsercltlvfefmekdlkkvldenktglqdsqikiylyqllrgvahchqhrilhrd
lkpqnllinsdgalkladfglarafgipvrhevvtlwyrapdvlmgskkystsvdiwsig
cifaemitgkplfpgvtdddqlpkifsilgtpnprewpqvqelplwkqrtfqvfekkpws
siipgfcqegidllsnmlcfdpnkrisardamnhpyfkdldpqi

SCOPe Domain Coordinates for d3niza1:

Click to download the PDB-style file with coordinates for d3niza1.
(The format of our PDB-style files is described here.)

Timeline for d3niza1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3niza2