Lineage for d3niza_ (3niz A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1042202Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1042203Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1042269Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1043604Protein automated matches [190091] (8 species)
    not a true protein
  7. 1043664Species Cryptosporidium parvum [TaxId:353152] [188006] (2 PDB entries)
  8. 1043665Domain d3niza_: 3niz A: [182332]
    automated match to d1ob3a_
    complexed with adp, mg

Details for d3niza_

PDB Entry: 3niz (more details), 2.4 Å

PDB Description: cryptosporidium parvum cyclin-dependent kinase cgd5_2510 with adp bound.
PDB Compounds: (A:) Rhodanese family protein

SCOPe Domain Sequences for d3niza_:

Sequence, based on SEQRES records: (download)

>d3niza_ d.144.1.7 (A:) automated matches {Cryptosporidium parvum [TaxId: 353152]}
yfqglmekyqklekvgegtygvvykakdsqgrivalkrirldaedegipstaireisllk
elhhpnivslidvihsercltlvfefmekdlkkvldenktglqdsqikiylyqllrgvah
chqhrilhrdlkpqnllinsdgalkladfglarafgipvrsythevvtlwyrapdvlmgs
kkystsvdiwsigcifaemitgkplfpgvtdddqlpkifsilgtpnprewpqvqelplwk
qrtfqvfekkpwssiipgfcqegidllsnmlcfdpnkrisardamnhpyfkdldpqi

Sequence, based on observed residues (ATOM records): (download)

>d3niza_ d.144.1.7 (A:) automated matches {Cryptosporidium parvum [TaxId: 353152]}
yfqglmekyqklekvgegtygvvykakdsqgrivalkrirgipstaireisllkelhhpn
ivslidvihsercltlvfefmekdlkkvldenktglqdsqikiylyqllrgvahchqhri
lhrdlkpqnllinsdgalkladfglarafgipvrhevvtlwyrapdvlmgskkystsvdi
wsigcifaemitgkplfpgvtdddqlpkifsilgtpnprewpqvqelplwkqrtfqvfek
kpwssiipgfcqegidllsnmlcfdpnkrisardamnhpyfkdldpqi

SCOPe Domain Coordinates for d3niza_:

Click to download the PDB-style file with coordinates for d3niza_.
(The format of our PDB-style files is described here.)

Timeline for d3niza_: