Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.3: beta-glycanases [51487] (27 proteins) consist of a number of sequence families |
Protein automated matches [190057] (11 species) not a true protein |
Species Thermotoga petrophila [TaxId:390874] [189941] (2 PDB entries) |
Domain d3niya_: 3niy A: [182330] automated match to d1vbra1 complexed with act, so4 |
PDB Entry: 3niy (more details), 1.58 Å
SCOPe Domain Sequences for d3niya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3niya_ c.1.8.3 (A:) automated matches {Thermotoga petrophila [TaxId: 390874]} hmqnvslrelaeklniyigfaainnfwslsdeekymevarrefniltpenqmkwdtihpe rdrynftpaekhvefaeennmivhghtlvwhnqlpgwitgrewtkeellnvledhiktvv shfkgrvkiwdvvneavsdsgtyresvwyktigpeyiekafrwtkeadpdailiyndysi eeinaksnfvynmikelkekgvpvdgigfqmhidyrglnydsfrrnlerfaklglqiyit emdvriplsgsedyylkkqaeicakifdicldnpavkaiqfwgftdkyswvpgffkgygk allfdenynpkpcyyaikevlekkie
Timeline for d3niya_: