Lineage for d3niya_ (3niy A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 968086Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 969862Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 970330Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 970857Protein automated matches [190057] (11 species)
    not a true protein
  7. 970896Species Thermotoga petrophila [TaxId:390874] [189941] (2 PDB entries)
  8. 970897Domain d3niya_: 3niy A: [182330]
    automated match to d1vbra1
    complexed with act, so4

Details for d3niya_

PDB Entry: 3niy (more details), 1.58 Å

PDB Description: crystal structure of native xylanase 10b from thermotoga petrophila rku-1
PDB Compounds: (A:) endo-1,4-beta-xylanase

SCOPe Domain Sequences for d3niya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3niya_ c.1.8.3 (A:) automated matches {Thermotoga petrophila [TaxId: 390874]}
hmqnvslrelaeklniyigfaainnfwslsdeekymevarrefniltpenqmkwdtihpe
rdrynftpaekhvefaeennmivhghtlvwhnqlpgwitgrewtkeellnvledhiktvv
shfkgrvkiwdvvneavsdsgtyresvwyktigpeyiekafrwtkeadpdailiyndysi
eeinaksnfvynmikelkekgvpvdgigfqmhidyrglnydsfrrnlerfaklglqiyit
emdvriplsgsedyylkkqaeicakifdicldnpavkaiqfwgftdkyswvpgffkgygk
allfdenynpkpcyyaikevlekkie

SCOPe Domain Coordinates for d3niya_:

Click to download the PDB-style file with coordinates for d3niya_.
(The format of our PDB-style files is described here.)

Timeline for d3niya_: