SCOPe 2.01: Domain d3nioc_: 3nio C:

Lineage for d3nioc_ (3nio C:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
   3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456

4. Superfamily c.42.1: Arginase/deacetylase [52768] (3 families)

5. Family c.42.1.0: automated matches [191435] (1 protein)
   not a true family

6. Protein automated matches [190626] (3 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:208964] [189976] (1 PDB entry)

8. Domain d3nioc_: 3nio C: [182324]
   automated match to d1gq6a_
   complexed with mn

Details for d3nioc_

PDB Entry: 3nio, 2 Å

PDB Description: Crystal structure of Pseudomonas aeruginosa guanidinobutyrase

PDB Compounds: (C:) Guanidinobutyrase

SCOPe Domain Sequences for d3nioc_:

Sequence; same for both SEQRES and ATOM records:

>d3nioc_ c.42.1.0 (C:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
nlhqplggnemprfggiatmmrlphvqspaeldaldaafvgvpldigtslrsgtrfgpre
iraesvmirpynmatgaapfdslnvadigdvaintfnlleavriieqeydrilghgilpl
tlggdhtitlpilraikkkhgkvglvhvdahadvndhmfgekiahgttfrraveedlldc
drvvqiglraqgytaedfnwsrkqgfrvvqaeecwhksleplmaevrekvgggpvylsfd
idgidpawapgtgtpeigglttiqameiirgcqgldligcdlvevsppydttgntsllga
nllyemlcvlpgvvrr

Timeline for d3nioc_:

• d3nioc_ is new in SCOPe 2.01-stable
  
• d3nioc_ appears in SCOPe 2.02
  
• d3nioc_ appears in the current release, SCOPe 2.08