|  | Class a: All alpha proteins [46456] (284 folds) | 
|  | Fold a.66: Transducin (alpha subunit), insertion domain [47894] (1 superfamily) 5 helices; folded leaf | 
|  | Superfamily a.66.1: Transducin (alpha subunit), insertion domain [47895] (1 family)  this domain interrupts the G-protein common fold | 
|  | Family a.66.1.1: Transducin (alpha subunit), insertion domain [47896] (1 protein) | 
|  | Protein Transducin (alpha subunit), insertion domain [47897] (4 species) | 
|  | Species Norway rat (Rattus norvegicus) [TaxId:10116] [47899] (19 PDB entries) | 
|  | Domain d1agrd1: 1agr D:61-181 [18229] Other proteins in same PDB: d1agra2, d1agrd2, d1agre_, d1agrh_ complexed with alf, cit, gdp, mg | 
PDB Entry: 1agr (more details), 2.8 Å
SCOPe Domain Sequences for d1agrd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1agrd1 a.66.1.1 (D:61-181) Transducin (alpha subunit), insertion domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
yseeeckqykavvysntiqsiiaiiramgrlkidfgdaaraddarqlfvlagaaeegfmt
aelagvikrlwkdsgvqacfnrsreyqlndsaayylndldriaqpnyiptqqdvlrtrvk
t
Timeline for d1agrd1:
|  View in 3D Domains from other chains: (mouse over for more information) d1agra1, d1agra2, d1agre_, d1agrh_ |