Lineage for d3nh8a_ (3nh8 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2887810Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2889494Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families) (S)
    core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest
  5. 2890040Family c.56.5.0: automated matches [191553] (1 protein)
    not a true family
  6. 2890041Protein automated matches [190955] (7 species)
    not a true protein
  7. 2890049Species Mouse (Mus musculus) [TaxId:10090] [189496] (4 PDB entries)
  8. 2890053Domain d3nh8a_: 3nh8 A: [182286]
    automated match to d2i3ca1
    complexed with cl, dc2, zn

Details for d3nh8a_

PDB Entry: 3nh8 (more details), 2.8 Å

PDB Description: Crystal structure of murine aminoacylase 3 in complex with N-acetyl-S-1,2-dichlorovinyl-L-cysteine
PDB Compounds: (A:) Aspartoacylase-2

SCOPe Domain Sequences for d3nh8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nh8a_ c.56.5.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
srepllrvavtggthgnemcgvylarywlqnpgelqrpsfsampvlanpaataaccryld
rdlnrsctltflgstatpddpyevkrarelnqllgpkgtgqafdftldlhnttantgvcl
isesnisfnlhlchylqrqnpgmpcrlflyepagtetfsvesiskngiclamgpqpqgvl
radlfsrmralvasildfielfnqgmdlpafemdiyrnlgsvdfprtadgdlagtvhpql
qdhdfeplrpgepifklfsgedvlyegdsivypvfineaayyekhvaflksekirvtvpa
llrltp

SCOPe Domain Coordinates for d3nh8a_:

Click to download the PDB-style file with coordinates for d3nh8a_.
(The format of our PDB-style files is described here.)

Timeline for d3nh8a_: