![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
![]() | Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families) ![]() core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest |
![]() | Family c.56.5.0: automated matches [191553] (1 protein) not a true family |
![]() | Protein automated matches [190955] (7 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [189496] (4 PDB entries) |
![]() | Domain d3nh8a_: 3nh8 A: [182286] automated match to d2i3ca1 complexed with cl, dc2, zn |
PDB Entry: 3nh8 (more details), 2.8 Å
SCOPe Domain Sequences for d3nh8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3nh8a_ c.56.5.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} srepllrvavtggthgnemcgvylarywlqnpgelqrpsfsampvlanpaataaccryld rdlnrsctltflgstatpddpyevkrarelnqllgpkgtgqafdftldlhnttantgvcl isesnisfnlhlchylqrqnpgmpcrlflyepagtetfsvesiskngiclamgpqpqgvl radlfsrmralvasildfielfnqgmdlpafemdiyrnlgsvdfprtadgdlagtvhpql qdhdfeplrpgepifklfsgedvlyegdsivypvfineaayyekhvaflksekirvtvpa llrltp
Timeline for d3nh8a_: