SCOPe 2.05: Domain d3nh5a_: 3nh5 A:

Lineage for d3nh5a_ (3nh5 A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families)
   core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest

5. Family c.56.5.0: automated matches [191553] (1 protein)
   not a true family

6. Protein automated matches [190955] (5 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [189496] (4 PDB entries)

8. Domain d3nh5a_: 3nh5 A: [182285]
   automated match to d2i3ca1
   complexed with act, cl, fmt, zn; mutant

Details for d3nh5a_

PDB Entry: 3nh5, 2.09 Å

PDB Description: Crystal structure of E177A-mutant murine aminoacylase 3

PDB Compounds: (A:) Aspartoacylase-2

SCOPe Domain Sequences for d3nh5a_:

Sequence; same for both SEQRES and ATOM records:

>d3nh5a_ c.56.5.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
srepllrvavtggthgnemcgvylarywlqnpgelqrpsfsampvlanpaataaccryld
rdlnrsctltflgstatpddpyevkrarelnqllgpkgtgqafdftldlhnttantgvcl
isesnisfnlhlchylqrqnpgmpcrlflyepagtetfsvesiskngiclamgpqpqgvl
radlfsrmralvasildfielfnqgmdlpafemdiyrnlgsvdfprtadgdlagtvhpql
qdhdfeplrpgepifklfsgedvlyegdsivypvfineaayyekhvaflksekirvtvpa
llrltp

Timeline for d3nh5a_:

• d3nh5a_ first appeared in SCOPe 2.01
  
• d3nh5a_ appears in SCOPe 2.04
  
• d3nh5a_ appears in SCOPe 2.06
  
• d3nh5a_ appears in the current release, SCOPe 2.08