SCOPe 2.03: Domain d3ngub_: 3ngu B:

Lineage for d3ngub_ (3ngu B:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families)

5. Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)

6. Protein automated matches [190032] (11 species)
   not a true protein

7. Species Leishmania major [TaxId:5664] [189935] (4 PDB entries)

8. Domain d3ngub_: 3ngu B: [182283]
   automated match to d1nuea_
   complexed with adp

Details for d3ngub_

PDB Entry: 3ngu, 2.29 Å

PDB Description: structure of leishmania ndkb complexed with adp.

PDB Compounds: (B:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d3ngub_:

Sequence; same for both SEQRES and ATOM records:

>d3ngub_ d.58.6.1 (B:) automated matches {Leishmania major [TaxId: 5664]}
mssertfiavkpdgvqrglvgeiiarferkgyklvalkilqptteqaqghykdlcskpff
palvkyfssgpivcmvwegknvvksgrvllgatnpadsqpgtirgdfavdvgrnvchgsd
svesaereiafwfkadeiaswtshsvsqiye

Timeline for d3ngub_:

• d3ngub_ first appeared in SCOPe 2.01
  
• d3ngub_ appears in SCOPe 2.02
  
• d3ngub_ appears in SCOPe 2.04
  
• d3ngub_ appears in the current release, SCOPe 2.08