Lineage for d1agra1 (1agr A:61-181)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1739075Fold a.66: Transducin (alpha subunit), insertion domain [47894] (1 superfamily)
    5 helices; folded leaf
  4. 1739076Superfamily a.66.1: Transducin (alpha subunit), insertion domain [47895] (1 family) (S)
    this domain interrupts the G-protein common fold
  5. 1739077Family a.66.1.1: Transducin (alpha subunit), insertion domain [47896] (1 protein)
  6. 1739078Protein Transducin (alpha subunit), insertion domain [47897] (4 species)
  7. 1739127Species Norway rat (Rattus norvegicus) [TaxId:10116] [47899] (19 PDB entries)
  8. 1739141Domain d1agra1: 1agr A:61-181 [18228]
    Other proteins in same PDB: d1agra2, d1agrd2, d1agre_, d1agrh_
    complexed with alf, cit, gdp, mg

Details for d1agra1

PDB Entry: 1agr (more details), 2.8 Å

PDB Description: complex of alf4-activated gi-alpha-1 with rgs4
PDB Compounds: (A:) guanine nucleotide-binding protein g(I)

SCOPe Domain Sequences for d1agra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1agra1 a.66.1.1 (A:61-181) Transducin (alpha subunit), insertion domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
yseeeckqykavvysntiqsiiaiiramgrlkidfgdaaraddarqlfvlagaaeegfmt
aelagvikrlwkdsgvqacfnrsreyqlndsaayylndldriaqpnyiptqqdvlrtrvk
t

SCOPe Domain Coordinates for d1agra1:

Click to download the PDB-style file with coordinates for d1agra1.
(The format of our PDB-style files is described here.)

Timeline for d1agra1: