Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) |
Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins) |
Protein automated matches [190032] (18 species) not a true protein |
Species Leishmania major [TaxId:5664] [189935] (7 PDB entries) |
Domain d3ngtf_: 3ngt F: [182273] automated match to d1nuea_ complexed with amp |
PDB Entry: 3ngt (more details), 2.57 Å
SCOPe Domain Sequences for d3ngtf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ngtf_ d.58.6.1 (F:) automated matches {Leishmania major [TaxId: 5664]} ssertfiavkpdgvqrglvgeiiarferkgyklvalkilqptteqaqghykdlcskpffp alvkyfssgpivcmvwegknvvksgrvllgatnpadsqpgtirgdfavdvgrnvchgsds vesaereiafwfkadeiaswtshsvsqiye
Timeline for d3ngtf_: