Lineage for d3ngtd_ (3ngt D:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1026488Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1027566Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 1027567Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)
  6. 1027789Protein automated matches [190032] (8 species)
    not a true protein
  7. 1027898Species Leishmania major [TaxId:5664] [189935] (4 PDB entries)
  8. 1027907Domain d3ngtd_: 3ngt D: [182271]
    automated match to d1nuea_
    complexed with amp

Details for d3ngtd_

PDB Entry: 3ngt (more details), 2.57 Å

PDB Description: structure of leishmania ndkb complexed with amp.
PDB Compounds: (D:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d3ngtd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ngtd_ d.58.6.1 (D:) automated matches {Leishmania major [TaxId: 5664]}
ssertfiavkpdgvqrglvgeiiarferkgyklvalkilqptteqaqghykdlcskpffp
alvkyfssgpivcmvwegknvvksgrvllgatnpadsqpgtirgdfavdvgrnvchgsds
vesaereiafwfkadeiaswtshsvsqiye

SCOPe Domain Coordinates for d3ngtd_:

Click to download the PDB-style file with coordinates for d3ngtd_.
(The format of our PDB-style files is described here.)

Timeline for d3ngtd_: