Lineage for d1as2_1 (1as2 61-181)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 540066Fold a.66: Transducin (alpha subunit), insertion domain [47894] (1 superfamily)
    5 helices; folded leaf
  4. 540067Superfamily a.66.1: Transducin (alpha subunit), insertion domain [47895] (1 family) (S)
    this domain interrupts the G-protein common fold
  5. 540068Family a.66.1.1: Transducin (alpha subunit), insertion domain [47896] (1 protein)
  6. 540069Protein Transducin (alpha subunit), insertion domain [47897] (2 species)
  7. 540089Species Rat (Rattus norvegicus) [TaxId:10116] [47899] (18 PDB entries)
  8. 540102Domain d1as2_1: 1as2 61-181 [18227]
    Other proteins in same PDB: d1as2_2
    complexed with gdp, po4; mutant

Details for d1as2_1

PDB Entry: 1as2 (more details), 2.8 Å

PDB Description: gdp+pi bound g42v gia1

SCOP Domain Sequences for d1as2_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1as2_1 a.66.1.1 (61-181) Transducin (alpha subunit), insertion domain {Rat (Rattus norvegicus)}
yseeeckqykavvysntiqsiiaiiramgrlkidfgdaaraddarqlfvlagaaeegfmt
aelagvikrlwkdsgvqacfnrsreyqlndsaayylndldriaqpnyiptqqdvlrtrvk
t

SCOP Domain Coordinates for d1as2_1:

Click to download the PDB-style file with coordinates for d1as2_1.
(The format of our PDB-style files is described here.)

Timeline for d1as2_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1as2_2