Lineage for d3ngta_ (3ngt A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951070Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 2951071Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins)
  6. 2951327Protein automated matches [190032] (18 species)
    not a true protein
  7. 2951474Species Leishmania major [TaxId:5664] [189935] (7 PDB entries)
  8. 2951482Domain d3ngta_: 3ngt A: [182268]
    automated match to d1nuea_
    complexed with amp

Details for d3ngta_

PDB Entry: 3ngt (more details), 2.57 Å

PDB Description: structure of leishmania ndkb complexed with amp.
PDB Compounds: (A:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d3ngta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ngta_ d.58.6.1 (A:) automated matches {Leishmania major [TaxId: 5664]}
ssertfiavkpdgvqrglvgeiiarferkgyklvalkilqptteqaqghykdlcskpffp
alvkyfssgpivcmvwegknvvksgrvllgatnpadsqpgtirgdfavdvgrnvchgsds
vesaereiafwfkadeiaswtshsvsqiye

SCOPe Domain Coordinates for d3ngta_:

Click to download the PDB-style file with coordinates for d3ngta_.
(The format of our PDB-style files is described here.)

Timeline for d3ngta_: