Lineage for d3ngfa_ (3ngf A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2839044Superfamily c.1.15: Xylose isomerase-like [51658] (8 families) (S)
    different families share similar but non-identical metal-binding sites
  5. 2839418Family c.1.15.0: automated matches [191634] (1 protein)
    not a true family
  6. 2839419Protein automated matches [191168] (5 species)
    not a true protein
  7. 2839429Species Brucella melitensis [TaxId:359391] [189392] (1 PDB entry)
  8. 2839430Domain d3ngfa_: 3ngf A: [182260]
    Other proteins in same PDB: d3ngfb2
    automated match to d1k77a_
    complexed with gol, mn

Details for d3ngfa_

PDB Entry: 3ngf (more details), 1.8 Å

PDB Description: Crystal structure of AP endonuclease, family 2 from Brucella melitensis
PDB Compounds: (A:) AP endonuclease, family 2

SCOPe Domain Sequences for d3ngfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ngfa_ c.1.15.0 (A:) automated matches {Brucella melitensis [TaxId: 359391]}
mprfaanlstmfnevpflerfrlaaeagfggveflfpydfdadviarelkqhnltqvlfn
mppgdwaagergmaaisgreqefrdnvdialhyalaldcrtlhamsgitegldrkaceet
fienfryaadklaphgitvlveplntrnmpgyfivhqleavglvkrvnrpnvavqldlyh
aqimdgdltrliekmngafshvqiasvpdrhepdegelnypylfsvlesvgyrgwvgcey
nprgktesglawfapyrd

SCOPe Domain Coordinates for d3ngfa_:

Click to download the PDB-style file with coordinates for d3ngfa_.
(The format of our PDB-style files is described here.)

Timeline for d3ngfa_: