Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.15: Xylose isomerase-like [51658] (8 families) different families share similar but non-identical metal-binding sites |
Family c.1.15.0: automated matches [191634] (1 protein) not a true family |
Protein automated matches [191168] (5 species) not a true protein |
Species Brucella melitensis [TaxId:359391] [189392] (1 PDB entry) |
Domain d3ngfa_: 3ngf A: [182260] Other proteins in same PDB: d3ngfb2 automated match to d1k77a_ complexed with gol, mn |
PDB Entry: 3ngf (more details), 1.8 Å
SCOPe Domain Sequences for d3ngfa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ngfa_ c.1.15.0 (A:) automated matches {Brucella melitensis [TaxId: 359391]} mprfaanlstmfnevpflerfrlaaeagfggveflfpydfdadviarelkqhnltqvlfn mppgdwaagergmaaisgreqefrdnvdialhyalaldcrtlhamsgitegldrkaceet fienfryaadklaphgitvlveplntrnmpgyfivhqleavglvkrvnrpnvavqldlyh aqimdgdltrliekmngafshvqiasvpdrhepdegelnypylfsvlesvgyrgwvgcey nprgktesglawfapyrd
Timeline for d3ngfa_: