Class a: All alpha proteins [46456] (289 folds) |
Fold a.66: Transducin (alpha subunit), insertion domain [47894] (1 superfamily) 5 helices; folded leaf |
Superfamily a.66.1: Transducin (alpha subunit), insertion domain [47895] (1 family) this domain interrupts the G-protein common fold |
Family a.66.1.1: Transducin (alpha subunit), insertion domain [47896] (1 protein) |
Protein Transducin (alpha subunit), insertion domain [47897] (4 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [47899] (19 PDB entries) |
Domain d1gg2a1: 1gg2 A:61-181 [18226] Other proteins in same PDB: d1gg2a2, d1gg2b_, d1gg2g_ complexed with gdp; mutant |
PDB Entry: 1gg2 (more details), 2.4 Å
SCOPe Domain Sequences for d1gg2a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gg2a1 a.66.1.1 (A:61-181) Transducin (alpha subunit), insertion domain {Norway rat (Rattus norvegicus) [TaxId: 10116]} yseeeckqykavvysntiqsiiaiiramgrlkidfgdaaraddarqlfvlagaaeegfmt aelagvikrlwkdsgvqacfnrsreyqlndsaayylndldriaqpnyiptqqdvlrtrvk t
Timeline for d1gg2a1: