![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
![]() | Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
![]() | Protein Hemoglobin, beta-chain [46500] (26 species) |
![]() | Species Antarctic fish (Trematomus newnesi) [TaxId:35730] [46513] (7 PDB entries) |
![]() | Domain d3ng6b_: 3ng6 B: [182255] Other proteins in same PDB: d3ng6a_, d3ng6c_ automated match to d1t1nb_ complexed with hem |
PDB Entry: 3ng6 (more details), 2.2 Å
SCOPe Domain Sequences for d3ng6b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ng6b_ a.1.1.2 (B:) Hemoglobin, beta-chain {Antarctic fish (Trematomus newnesi) [TaxId: 35730]} vewtdkersiisdifshmdyddigpkalsrclvvypwtqryfsgfgnlynaegimsnanv aahgikvlhgldrgmknmdniadaytdlstlhseklhvdpdnfkllsdcitivlaakmgh aftaetqgafqkflaavvsalgkqyh
Timeline for d3ng6b_: