Lineage for d3ng6a_ (3ng6 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2686238Protein Hemoglobin, alpha-chain [46486] (24 species)
  7. 2686243Species Antarctic fish (Trematomus newnesi) [TaxId:35730] [46497] (7 PDB entries)
  8. 2686250Domain d3ng6a_: 3ng6 A: [182254]
    Other proteins in same PDB: d3ng6b_, d3ng6d_
    automated match to d1la6a_
    complexed with hem

Details for d3ng6a_

PDB Entry: 3ng6 (more details), 2.2 Å

PDB Description: The crystal structure of hemoglobin I from Trematomus newnesi in deoxygenated state obtained through an oxidation/reduction cycle in which potassium hexacyanoferrate and sodium dithionite were alternatively added
PDB Compounds: (A:) Hemoglobin subunit alpha-1

SCOPe Domain Sequences for d3ng6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ng6a_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Antarctic fish (Trematomus newnesi) [TaxId: 35730]}
slsdkdkaavralwskigkssdaigndalsrmivvypqtkiyfshwpdvtpgspnikahg
kkvmggialavskiddlktglmelseqhayklrvdpsnfkilnhcilvvistmfpkeftp
eahvsldkflsgvalalaeryr

SCOPe Domain Coordinates for d3ng6a_:

Click to download the PDB-style file with coordinates for d3ng6a_.
(The format of our PDB-style files is described here.)

Timeline for d3ng6a_: