Lineage for d3ng3b_ (3ng3 B:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1342158Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 1343361Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 1343362Protein automated matches [190115] (51 species)
    not a true protein
  7. 1343621Species Mycobacterium avium [TaxId:243243] [189378] (1 PDB entry)
  8. 1343623Domain d3ng3b_: 3ng3 B: [182245]
    automated match to d1j2wa_
    complexed with cl, edo, unl

Details for d3ng3b_

PDB Entry: 3ng3 (more details), 2.15 Å

PDB Description: crystal structure of deoxyribose phosphate aldolase from mycobacterium avium 104 in a schiff base with an unknown aldehyde
PDB Compounds: (B:) deoxyribose-phosphate aldolase

SCOPe Domain Sequences for d3ng3b_:

Sequence, based on SEQRES records: (download)

>d3ng3b_ c.1.10.0 (B:) automated matches {Mycobacterium avium [TaxId: 243243]}
ptraqlaafvdhtllkpeataadvaalvteaaelgvyavcvsppmvpaavqagagvrvas
vagfpsgkhvsavkaheaalavasgaaeidmvidvgaalagdldgvradiaavrgavgga
vlkvivessallaladehtlvrvcraaedagadfvktstgfhpsggasvravalmaeavg
grlgvkasggirtaadalamldagatrlglsgtravldgl

Sequence, based on observed residues (ATOM records): (download)

>d3ng3b_ c.1.10.0 (B:) automated matches {Mycobacterium avium [TaxId: 243243]}
ptraqlaafvdhtllkpeataadvaalvteaaelgvyavcvsppmvpaavqarvasvagf
psgkhvsavkaheaalavasgaaeidmvidvgaalagdldgvradiaavrgavggavlkv
ivessallaladehtlvrvcraaedagadfvktstgfhpsggasvravalmaeavggrlg
vkasggirtaadalamldagatrlglsgtravldgl

SCOPe Domain Coordinates for d3ng3b_:

Click to download the PDB-style file with coordinates for d3ng3b_.
(The format of our PDB-style files is described here.)

Timeline for d3ng3b_: