SCOPe 2.07: Domain d3nfld_: 3nfl D:

Lineage for d3nfld_ (3nfl D:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.1: PDZ domain [50157] (47 proteins)
   Pfam PF00595

6. Protein Tyrosine-protein phosphatase non-receptor type 4, PTPN4 [141286] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [141287] (3 PDB entries)
   Uniprot P29074 507-612

8. Domain d3nfld_: 3nfl D: [182237]
   automated match to d2cs5a1

Details for d3nfld_

PDB Entry: 3nfl, 1.91 Å

PDB Description: Crystal structure of the PTPN4 PDZ domain complexed with the C-terminus of the GluN2A NMDA receptor subunit

PDB Compounds: (D:) tyrosine-protein phosphatase non-receptor type 4

SCOPe Domain Sequences for d3nfld_:

Sequence, based on SEQRES records:

>d3nfld_ b.36.1.1 (D:) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]}
dnlvlirmkpdengrfgfnvkggydqkmpvivsrvapgtpadlcvprlnegdqvvlingr
diaehthdqvvlfikascerhsgelmllvrpn

Sequence, based on observed residues (ATOM records):

>d3nfld_ b.36.1.1 (D:) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]}
dnlvlirmkpdengrfgfnvkggydqkmpvivsrvapgtpadlcvprlnegdqvvlingr
diaehthdqvvlfikascegelmllvrpn

Timeline for d3nfld_:

• d3nfld_ first appeared in SCOPe 2.01
  
• d3nfld_ appears in SCOPe 2.06
  
• d3nfld_ appears in the current release, SCOPe 2.08