Lineage for d3nfkb_ (3nfk B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2785883Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2785884Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2785885Family b.36.1.1: PDZ domain [50157] (47 proteins)
    Pfam PF00595
  6. 2786220Protein Tyrosine-protein phosphatase non-receptor type 4, PTPN4 [141286] (1 species)
  7. 2786221Species Human (Homo sapiens) [TaxId:9606] [141287] (3 PDB entries)
    Uniprot P29074 507-612
  8. 2786223Domain d3nfkb_: 3nfk B: [182233]
    automated match to d2cs5a1
    complexed with gol

Details for d3nfkb_

PDB Entry: 3nfk (more details), 1.43 Å

PDB Description: Crystal structure of the PTPN4 PDZ domain complexed with the C-terminus of a rabies virus G protein
PDB Compounds: (B:) tyrosine-protein phosphatase non-receptor type 4

SCOPe Domain Sequences for d3nfkb_:

Sequence, based on SEQRES records: (download)

>d3nfkb_ b.36.1.1 (B:) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]}
hdnlvlirmkpdengrfgfnvkggydqkmpvivsrvapgtpadlcvprlnegdqvvling
rdiaehthdqvvlfikascerhsgelmllvrpn

Sequence, based on observed residues (ATOM records): (download)

>d3nfkb_ b.36.1.1 (B:) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]}
hdnlvlirmkpdengrfgfnvkggydqkmpvivsrvapgtpadlcvprlnegdqvvling
rdiaehthdqvvlfikascesgelmllvrpn

SCOPe Domain Coordinates for d3nfkb_:

Click to download the PDB-style file with coordinates for d3nfkb_.
(The format of our PDB-style files is described here.)

Timeline for d3nfkb_: