SCOPe 2.06: Domain d3nfka_: 3nfk A:

Lineage for d3nfka_ (3nfk A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.1: PDZ domain [50157] (47 proteins)
   Pfam PF00595

6. Protein Tyrosine-protein phosphatase non-receptor type 4, PTPN4 [141286] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [141287] (3 PDB entries)
   Uniprot P29074 507-612

8. Domain d3nfka_: 3nfk A: [182232]
   automated match to d2cs5a1
   complexed with gol

Details for d3nfka_

PDB Entry: 3nfk, 1.43 Å

PDB Description: Crystal structure of the PTPN4 PDZ domain complexed with the C-terminus of a rabies virus G protein

PDB Compounds: (A:) tyrosine-protein phosphatase non-receptor type 4

SCOPe Domain Sequences for d3nfka_:

Sequence; same for both SEQRES and ATOM records:

>d3nfka_ b.36.1.1 (A:) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]}
dnlvlirmkpdengrfgfnvkggydqkmpvivsrvapgtpadlcvprlnegdqvvlingr
diaehthdqvvlfikascerhsgelmllvrpn

Timeline for d3nfka_:

• d3nfka_ first appeared in SCOPe 2.01
  
• d3nfka_ appears in SCOPe 2.05
  
• d3nfka_ appears in SCOPe 2.07
  
• d3nfka_ appears in the current release, SCOPe 2.08