Class b: All beta proteins [48724] (177 folds) |
Fold b.36: PDZ domain-like [50155] (1 superfamily) contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix |
Superfamily b.36.1: PDZ domain-like [50156] (7 families) peptide-binding domain |
Family b.36.1.1: PDZ domain [50157] (47 proteins) Pfam PF00595 |
Protein Tyrosine-protein phosphatase non-receptor type 4, PTPN4 [141286] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [141287] (3 PDB entries) Uniprot P29074 507-612 |
Domain d3nfka_: 3nfk A: [182232] automated match to d2cs5a1 complexed with gol |
PDB Entry: 3nfk (more details), 1.43 Å
SCOPe Domain Sequences for d3nfka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3nfka_ b.36.1.1 (A:) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]} dnlvlirmkpdengrfgfnvkggydqkmpvivsrvapgtpadlcvprlnegdqvvlingr diaehthdqvvlfikascerhsgelmllvrpn
Timeline for d3nfka_: