SCOPe 2.08: Domain d1gila1: 1gil A:61-181

Lineage for d1gila1 (1gil A:61-181)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.66: Transducin (alpha subunit), insertion domain [47894] (1 superfamily)
   5 helices; folded leaf

4. Superfamily a.66.1: Transducin (alpha subunit), insertion domain [47895] (1 family)
   this domain interrupts the G-protein common fold

5. Family a.66.1.1: Transducin (alpha subunit), insertion domain [47896] (1 protein)

6. Protein Transducin (alpha subunit), insertion domain [47897] (4 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [47899] (19 PDB entries)

8. Domain d1gila1: 1gil A:61-181 [18223]
   Other proteins in same PDB: d1gila2
   complexed with gsp, mg

Details for d1gila1

PDB Entry: 1gil, 2.3 Å

PDB Description: structure of active conformations of gia1 and the mechanism of gtp hydrolysis

PDB Compounds: (A:) g protein gi alpha 1

SCOPe Domain Sequences for d1gila1:

Sequence; same for both SEQRES and ATOM records:

>d1gila1 a.66.1.1 (A:61-181) Transducin (alpha subunit), insertion domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
yseeeckqykavvysntiqsiiaiiramgrlkidfgdaaraddarqlfvlagaaeegfmt
aelagvikrlwkdsgvqacfnrsreyqlndsaayylndldriaqpnyiptqqdvlrtrvk
t

Timeline for d1gila1:

• d1gila1 first appeared (with stable ids) in SCOP 1.55, called d1gil_1
  
• d1gila1 appears in SCOPe 2.07