![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.6: Cell growth inhibitor/plasmid maintenance toxic component [50118] (4 families) ![]() contains insert beta-sheet subdomain and C-terminal helix |
![]() | Family b.34.6.2: Kid/PemK [82075] (4 proteins) automatically mapped to Pfam PF02452 |
![]() | Protein MazF protein [89303] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [89304] (2 PDB entries) |
![]() | Domain d3nfcd_: 3nfc D: [182225] automated match to d1ub4a_ |
PDB Entry: 3nfc (more details), 2 Å
SCOPe Domain Sequences for d3nfcd_:
Sequence, based on SEQRES records: (download)
>d3nfcd_ b.34.6.2 (D:) MazF protein {Escherichia coli [TaxId: 562]} yvpdmgdliwvdfdptkgseqaghrpavvlspfmynnktgmclcvpcttqskgypfevvl sgqerdgvaladqvksiawrargatkkgtvapeelqlikakinvlig
>d3nfcd_ b.34.6.2 (D:) MazF protein {Escherichia coli [TaxId: 562]} yvpdmgdliwvdfhrpavvlspfmynnktgmclcvpcttqskgypfevvlsggvaladqv ksiawrargatkkgtvapeelqlikakinvlig
Timeline for d3nfcd_: