Lineage for d3nfcb_ (3nfc B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2784275Superfamily b.34.6: Cell growth inhibitor/plasmid maintenance toxic component [50118] (4 families) (S)
    contains insert beta-sheet subdomain and C-terminal helix
  5. 2784312Family b.34.6.2: Kid/PemK [82075] (4 proteins)
    automatically mapped to Pfam PF02452
  6. 2784319Protein MazF protein [89303] (2 species)
  7. 2784323Species Escherichia coli [TaxId:562] [89304] (2 PDB entries)
  8. 2784327Domain d3nfcb_: 3nfc B: [182223]
    automated match to d1ub4a_

Details for d3nfcb_

PDB Entry: 3nfc (more details), 2 Å

PDB Description: Crystal structure of E.coli MazF Toxin
PDB Compounds: (B:) PemK-like protein 1

SCOPe Domain Sequences for d3nfcb_:

Sequence, based on SEQRES records: (download)

>d3nfcb_ b.34.6.2 (B:) MazF protein {Escherichia coli [TaxId: 562]}
yvpdmgdliwvdfdptkgseqaghrpavvlspfmynnktgmclcvpcttqskgypfevvl
sgqerdgvaladqvksiawrargatkkgtvapeelqlikakinvlig

Sequence, based on observed residues (ATOM records): (download)

>d3nfcb_ b.34.6.2 (B:) MazF protein {Escherichia coli [TaxId: 562]}
yvpdmgdliwvdfrpavvlspfmynnktgmclcvpcttqskgypfevvlsggvaladqvk
siawrargatkkgtvapeelqlikakinvlig

SCOPe Domain Coordinates for d3nfcb_:

Click to download the PDB-style file with coordinates for d3nfcb_.
(The format of our PDB-style files is described here.)

Timeline for d3nfcb_: