SCOP 1.65: Domain d1git_1: 1git 61-181

Lineage for d1git_1 (1git 61-181)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.66: Transducin (alpha subunit), insertion domain [47894] (1 superfamily)
   5 helices; folded leaf

4. Superfamily a.66.1: Transducin (alpha subunit), insertion domain [47895] (1 family)
   this domain interrupts the G-protein common fold

5. Family a.66.1.1: Transducin (alpha subunit), insertion domain [47896] (1 protein)

6. Protein Transducin (alpha subunit), insertion domain [47897] (2 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [47899] (18 PDB entries)

8. Domain d1git_1: 1git 61-181 [18222]
   Other proteins in same PDB: d1git_2
   complexed with gdp, po4; mutant

Details for d1git_1

PDB Entry: 1git, 2.6 Å

PDB Description: structure of gtp-binding protein

SCOP Domain Sequences for d1git_1:

Sequence; same for both SEQRES and ATOM records:

>d1git_1 a.66.1.1 (61-181) Transducin (alpha subunit), insertion domain {Rat (Rattus norvegicus)}
yseeeckqykavvysntiqsiiaiiramgrlkidfgdaaraddarqlfvlagaaeegfmt
aelagvikrlwkdsgvqacfnrsreyqlndsaayylndldriaqpnyiptqqdvlrtrvk
t

Timeline for d1git_1:

• d1git_1 first appeared (with stable ids) in SCOP 1.55
  
• d1git_1 appears in SCOP 1.63
  
• d1git_1 appears in SCOP 1.67
  
• d1git_1 appears in the current release, SCOPe 2.08, called d1gita1