SCOPe 2.08: Domain d1gita1: 1git A:61-181

Lineage for d1gita1 (1git A:61-181)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.66: Transducin (alpha subunit), insertion domain [47894] (1 superfamily)
   5 helices; folded leaf

4. Superfamily a.66.1: Transducin (alpha subunit), insertion domain [47895] (1 family)
   this domain interrupts the G-protein common fold

5. Family a.66.1.1: Transducin (alpha subunit), insertion domain [47896] (1 protein)

6. Protein Transducin (alpha subunit), insertion domain [47897] (4 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [47899] (19 PDB entries)

8. Domain d1gita1: 1git A:61-181 [18222]
   Other proteins in same PDB: d1gita2
   complexed with gdp, po4

Details for d1gita1

PDB Entry: 1git, 2.6 Å

PDB Description: structure of gtp-binding protein

PDB Compounds: (A:) g protein gi alpha 1

SCOPe Domain Sequences for d1gita1:

Sequence; same for both SEQRES and ATOM records:

>d1gita1 a.66.1.1 (A:61-181) Transducin (alpha subunit), insertion domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
yseeeckqykavvysntiqsiiaiiramgrlkidfgdaaraddarqlfvlagaaeegfmt
aelagvikrlwkdsgvqacfnrsreyqlndsaayylndldriaqpnyiptqqdvlrtrvk
t

Timeline for d1gita1:

• d1gita1 first appeared (with stable ids) in SCOP 1.55, called d1git_1
  
• d1gita1 appears in SCOPe 2.07