Lineage for d3nezd_ (3nez D:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1898883Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 1898884Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 1898885Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. 1899146Protein automated matches [190406] (16 species)
    not a true protein
  7. 1899215Species Coral (Discosoma sp.) [TaxId:86600] [188539] (17 PDB entries)
  8. 1899251Domain d3nezd_: 3nez D: [182215]
    automated match to d1g7ka_

Details for d3nezd_

PDB Entry: 3nez (more details), 1.7 Å

PDB Description: mrojoa
PDB Compounds: (D:) mRojoA

SCOPe Domain Sequences for d3nezd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nezd_ d.22.1.1 (D:) automated matches {Coral (Discosoma sp.) [TaxId: 86600]}
maiikefmrfkthmegsvnghefeiegegegrpyegtqtaklkvtkggplpfawdilspq
fmygmygskayvkhpadipdylklsfpegfkwervmnfedggvvtvtqdsslqdgefiyk
vklhgtnfpsdgpvmqkktmgweassermypedgalkgeiklrlklkdgghydaevktty
kakkpvqlpgaynanyklditshnedytiveqyercegrhs

SCOPe Domain Coordinates for d3nezd_:

Click to download the PDB-style file with coordinates for d3nezd_.
(The format of our PDB-style files is described here.)

Timeline for d3nezd_: