Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
Superfamily d.22.1: GFP-like [54511] (3 families) |
Family d.22.1.1: Fluorescent proteins [54512] (6 proteins) |
Protein automated matches [190406] (16 species) not a true protein |
Species Coral (Discosoma sp.) [TaxId:86600] [188539] (17 PDB entries) |
Domain d3nezd_: 3nez D: [182215] automated match to d1g7ka_ |
PDB Entry: 3nez (more details), 1.7 Å
SCOPe Domain Sequences for d3nezd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3nezd_ d.22.1.1 (D:) automated matches {Coral (Discosoma sp.) [TaxId: 86600]} maiikefmrfkthmegsvnghefeiegegegrpyegtqtaklkvtkggplpfawdilspq fmygmygskayvkhpadipdylklsfpegfkwervmnfedggvvtvtqdsslqdgefiyk vklhgtnfpsdgpvmqkktmgweassermypedgalkgeiklrlklkdgghydaevktty kakkpvqlpgaynanyklditshnedytiveqyercegrhs
Timeline for d3nezd_: