SCOPe 2.06: Domain d3nezc_: 3nez C:

Lineage for d3nezc_ (3nez C:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)

6. Protein automated matches [190406] (19 species)
   not a true protein

7. Species Coral (Discosoma sp.) [TaxId:86600] [188539] (21 PDB entries)

8. Domain d3nezc_: 3nez C: [182214]
   automated match to d1g7ka_

Details for d3nezc_

PDB Entry: 3nez, 1.7 Å

PDB Description: mrojoa

PDB Compounds: (C:) mRojoA

SCOPe Domain Sequences for d3nezc_:

Sequence; same for both SEQRES and ATOM records:

>d3nezc_ d.22.1.1 (C:) automated matches {Coral (Discosoma sp.) [TaxId: 86600]}
aiikefmrfkthmegsvnghefeiegegegrpyegtqtaklkvtkggplpfawdilspqf
mygmygskayvkhpadipdylklsfpegfkwervmnfedggvvtvtqdsslqdgefiykv
klhgtnfpsdgpvmqkktmgweassermypedgalkgeiklrlklkdgghydaevkttyk
akkpvqlpgaynanyklditshnedytiveqyercegrhs

Timeline for d3nezc_:

• d3nezc_ first appeared in SCOPe 2.01
  
• d3nezc_ appears in SCOPe 2.05
  
• d3nezc_ appears in SCOPe 2.07
  
• d3nezc_ appears in the current release, SCOPe 2.08