Lineage for d3nerb_ (3ner B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2579636Fold d.120: Cytochrome b5-like heme/steroid binding domain [55855] (1 superfamily)
    beta-alpha-beta(2)-alpha(1,2)-(beta)-alpha(2)-beta; 3 layers: a/b/a; antiparallel beta-sheet, order: 1532(4)
  4. 2579637Superfamily d.120.1: Cytochrome b5-like heme/steroid binding domain [55856] (3 families) (S)
  5. 2579638Family d.120.1.1: Cytochrome b5 [55857] (5 proteins)
  6. 2579709Protein automated matches [190702] (5 species)
    not a true protein
  7. 2579723Species Human (Homo sapiens) [TaxId:9606] [189965] (2 PDB entries)
  8. 2579725Domain d3nerb_: 3ner B: [182200]
    automated match to d1b5ma_
    complexed with hem, mg, so4

Details for d3nerb_

PDB Entry: 3ner (more details), 1.45 Å

PDB Description: Structure of Human Type B Cytochrome b5
PDB Compounds: (B:) Cytochrome b5 type B

SCOPe Domain Sequences for d3nerb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nerb_ d.120.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kgqevetsvtyyrleevakrnslkelwlvihgrvydvtrflnehpggeevlleqagvdas
esfedvghssdaremlkqyyigdihpsdlkp

SCOPe Domain Coordinates for d3nerb_:

Click to download the PDB-style file with coordinates for d3nerb_.
(The format of our PDB-style files is described here.)

Timeline for d3nerb_: